PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 107954
Common NameMICPUN_107954
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Mamiellaceae; Micromonas
Family SBP
Protein Properties Length: 470aa    MW: 48501 Da    PI: 5.6249
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
107954genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP31.83.6e-10125200176
             --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
     SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
             +Cqv++C +  ++     r    C  h  + + +  g+  r Cq C  fh +s fD + ++C +rL +   r r k
  107954 125 CCQVDDCLNPRKQPTANSRMPLTCAEHNGMLSLTYGGEASRECQACRAFHPVSAFDRDNKTCETRLLRKKLRYRAK 200
             6******9999999999999999*******************************************9998887755 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.2E-12123187IPR004333Transcription factor, SBP-box
PROSITE profilePS5114113.477123200IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.63E-10125202IPR004333Transcription factor, SBP-box
PfamPF031103.0E-18126199IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MRDENDIGAQ EPEEQDENPP ASPRSEPAAN AFGPGGFQED APEEGEKRVP IGDASADAAG  60
SPVEPAKEPE GNTVDQEQSA GAQPVVAANS ADASDPSDAA APDNTLRTAQ HAILLRQQAI  120
KYKGCCQVDD CLNPRKQPTA NSRMPLTCAE HNGMLSLTYG GEASRECQAC RAFHPVSAFD  180
RDNKTCETRL LRKKLRYRAK TLQQRDEHRG QVGKQKARRH EAALQAVAAA TAQPGVGVGL  240
GQFSHLQGPA GFMLPFGGKF LGVAHKDGGA DALAAARESI ASVNPYGMFP GLTHMPFGQG  300
AVEGSAAAAA SAFAASFGTG LGGDDNKIAI PQPGGINLQS LAGFPTRSNP AELAESSPAA  360
AQAYLAALVQ GNTGLSALAL QGAGLTGGIP GLAGLQNPDV LANLARQNNL QEQVAALRAN  420
HMLRIAQAAE MQASVAMANS RSTGGDILNR QNLYPHLASD PAQAGCSIM*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1191197RKKLRYR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0013240.0CP001324.1 Micromonas sp. RCC299 chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002500625.10.0predicted protein
TrEMBLC1E2A60.0C1E2A6_MICSR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1069424
Publications ? help Back to Top
  1. Worden AZ, et al.
    Green evolution and dynamic adaptations revealed by genomes of the marine picoeukaryotes Micromonas.
    Science, 2009. 324(5924): p. 268-72
    [PMID:19359590]